PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun002989
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family HD-ZIP
Protein Properties Length: 277aa    MW: 31570.3 Da    PI: 6.3182
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-33844PU_refplantGDBView CDS
gnl|UG|Vun#S45908814PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.2e-1874127356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Vun002989  74 KKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 127
                456899***********************************************9 PP

2HD-ZIP_I/II1322.3e-4273163191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ekkrrl+ eqvk+LE+sFe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+y+++k++n++L++++++L++e+
    Vun002989  73 EKKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQYESVKSDNDALQTQNQKLQAEI 163
                  69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-1962131IPR009057Homeodomain-like
PROSITE profilePS5007117.39469129IPR001356Homeobox domain
SMARTSM003891.8E-1872133IPR001356Homeobox domain
PfamPF000461.5E-1574127IPR001356Homeobox domain
CDDcd000864.20E-1674130No hitNo description
Gene3DG3DSA:1.10.10.602.1E-1976136IPR009057Homeodomain-like
PRINTSPR000311.1E-5100109IPR000047Helix-turn-helix motif
PROSITE patternPS000270104127IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5109125IPR000047Helix-turn-helix motif
PfamPF021831.2E-15129169IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MAFFPANFML QTPHHDDHHQ PPPSLTSILP PQEYHGGVTF LGKRSMSFSS GIEHGEEPNA  60
EEDLSDDGSQ AGEKKRRLNM EQVKTLEKSF ELGNKLEPER KMQLARALGL QPRQIAIWFQ  120
NRRARWKTKQ LEKDYDLLKR QYESVKSDND ALQTQNQKLQ AEILALKSRE PTESINLNKE  180
TEGSCSNRSE NSSDIKLDIS RTPAIDSPVS THQASRTLFP SSARPAGVAQ LFQTSSRPDL  240
PCQKIDQMVK EESLSNMFCA MDDQSGFWPW LEQQHFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121129RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014492595.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13-like isoform X2
SwissprotQ8LC031e-121ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0S3T2A00.0A0A0S3T2A0_PHAAN; Uncharacterized protein
STRINGGLYMA01G05230.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-118HD-ZIP family protein